SCOPe 2.08: Domain d7bj9b_: 7bj9 B:

Lineage for d7bj9b_ (7bj9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Serratia fonticola [TaxId:47917] [196325] (4 PDB entries)

8. Domain d7bj9b_: 7bj9 B: [420791]
   automated match to d3sd9a_
   complexed with gol, tww, zn

Details for d7bj9b_

PDB Entry: 7bj9, 1.21 Å

PDB Description: structure of sfh-i with 2-mercaptomethyl-thiazolidine l-anti-1a

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d7bj9b_:

Sequence; same for both SEQRES and ATOM records:

>d7bj9b_ d.157.1.1 (B:) automated matches {Serratia fonticola [TaxId: 47917]}
eknltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvspl
pinevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnle
kslpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfan
rteypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekap

Timeline for d7bj9b_:

• d7bj9b_ is new in SCOPe 2.08-stable