Lineage for d1usha2 (1ush A:26-362)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556189Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2556190Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2556243Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)
  6. 2556244Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)
  7. 2556245Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2556247Domain d1usha2: 1ush A:26-362 [42079]
    Other proteins in same PDB: d1usha1
    complexed with co3, so4, zn

Details for d1usha2

PDB Entry: 1ush (more details), 1.73 Å

PDB Description: 5'-nucleotidase from e. coli
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d1usha2:

Sequence, based on SEQRES records: (download)

>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

Sequence, based on observed residues (ATOM records): (download)

>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkrvly
tpeiaenqqmisllspfqnkgkaqlev

SCOPe Domain Coordinates for d1usha2:

Click to download the PDB-style file with coordinates for d1usha2.
(The format of our PDB-style files is described here.)

Timeline for d1usha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1usha1