PDB entry 1ush

View 1ush on RCSB PDB site
Description: 5'-nucleotidase from e. coli
Class: hydrolase
Keywords: 5'-nucleotidase, udp-sugar hydrolase, phosphatase, hydrolase (phosphoric monoester), periplasmic protein, hydrolase
Deposited on 1998-09-16, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase
    Species: Escherichia coli [TaxId:83333]
    Gene: USHA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1usha1, d1usha2
  • Heterogens: ZN, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ushA (A:)
    mkllqrgvalallttftlasetalayeqdktykitvlhtndhhghfwrneygeyglaaqk
    tlvdgirkevaaeggsvlllsggdintgvpesdlqdaepdfrgmnlvgydamaignhefd
    npltvlrqqekwakfpllsaniyqkstgerlfkpwalfkrqdlkiaviglttddtakign
    peyftdiefrkpadeaklviqelqqtekpdiiiaathmghydngehgsnapgdvemaral
    pagslamivgghsqdpvcmaaenkkqvdyvpgtpckpdqqngiwivqahewgkyvgradf
    efrngemkmvnyqlipvnlkkkvtwedgkservlytpeiaenqqmisllspfqnkgkaql
    evkigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisy
    knvlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlki
    kgepvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsv
    yepkgevswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ushA (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkrvly
    tpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnmgrlilaaqmd
    rtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevidyltavaqmkp
    dsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdgyprldnkpgy
    vntgfidaevlkayiqksspldvsvyepkgevswq