Lineage for d1pya.1 (1pya A:,B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224407Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 1224408Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 1224409Family d.155.1.1: Histidine decarboxylase [56272] (1 protein)
  6. 1224410Protein Histidine decarboxylase [56273] (1 species)
  7. 1224411Species Lactobacillus sp., strain 30a [TaxId:1591] [56274] (6 PDB entries)
  8. 1224412Domain d1pya.1: 1pya A:,B: [42026]

Details for d1pya.1

PDB Entry: 1pya (more details), 2.5 Å

PDB Description: refined structure of the pyruvoyl-dependent histidine decarboxylase from lactobacillus 30a
PDB Compounds: (A:) pyruvoyl-dependent histidine decarboxylase (l-histidine carboxylase), (B:) pyruvoyl-dependent histidine decarboxylase (l-histidine carboxylase)

SCOPe Domain Sequences for d1pya.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1pya.1 d.155.1.1 (A:,B:) Histidine decarboxylase {Lactobacillus sp., strain 30a [TaxId: 1591]}
seldaklnklgvdriaispykqwtrgymepgnigngyvtglkvdagvrdksdddvldgiv
sydraetknayigqinmttasXxftgvqgrvigydilrspevdkakplftetqwdgselp
iydakplqdalveyfgteqdrrhypapgsfivcankgvtaerpkndadmkpgqgygvwsa
iaisfakdptkdssmfvedagvwetpnedelleylegrrkamaksiaecgqdahasfess
wigfaytmmepgqignaitvapyvslpidsipggsiltpdkdmeimenltmpewlekmgy
kslsannalky

SCOPe Domain Coordinates for d1pya.1:

Click to download the PDB-style file with coordinates for d1pya.1.
(The format of our PDB-style files is described here.)

Timeline for d1pya.1: