Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries) |
Domain d5sb9f1: 5sb9 F:1-76 [420212] Other proteins in same PDB: d5sb9e_, d5sb9f2, d5sb9f3 automated match to d3tiia1 complexed with 5ix, acp, ca, gdp, gtp, imd, mes, mg |
PDB Entry: 5sb9 (more details), 2.5 Å
SCOPe Domain Sequences for d5sb9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sb9f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5sb9f1: