![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein c-src protein tyrosine kinase [50064] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries) |
![]() | Domain d7a3ba_: 7a3b A: [420186] automated match to d6xvma_ complexed with gol, pge; mutant |
PDB Entry: 7a3b (more details), 1.91 Å
SCOPe Domain Sequences for d7a3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a3ba_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} ttfvalydyesrtetdlsfkkgdrlqivnntegdwwlahslttgqtgyipsnyvaps
Timeline for d7a3ba_: