Lineage for d1g65q_ (1g65 Q:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197868Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species)
  7. 197884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
  8. 197922Domain d1g65q_: 1g65 Q: [41969]
    Other proteins in same PDB: d1g651_, d1g652_, d1g65h_, d1g65i_, d1g65j_, d1g65k_, d1g65l_, d1g65m_, d1g65n_, d1g65v_, d1g65w_, d1g65x_, d1g65y_, d1g65z_

Details for d1g65q_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors

SCOP Domain Sequences for d1g65q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65q_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOP Domain Coordinates for d1g65q_:

Click to download the PDB-style file with coordinates for d1g65q_.
(The format of our PDB-style files is described here.)

Timeline for d1g65q_: