Lineage for d1g0ua_ (1g0u A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335658Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 335743Protein Proteasome alpha subunit (non-catalytic) [56255] (4 species)
    contains an extension to the common fold at the N-teminus
  7. 335774Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 335789Domain d1g0ua_: 1g0u A: [41946]
    Other proteins in same PDB: d1g0u1_, d1g0u2_, d1g0uh_, d1g0ui_, d1g0uj_, d1g0uk_, d1g0ul_, d1g0um_, d1g0un_, d1g0uv_, d1g0uw_, d1g0ux_, d1g0uy_, d1g0uz_

Details for d1g0ua_

PDB Entry: 1g0u (more details), 2.4 Å

PDB Description: a gated channel into the proteasome core particle

SCOP Domain Sequences for d1g0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
ysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlskv
slltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqs
ggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndele
ledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqein
drleal

SCOP Domain Coordinates for d1g0ua_:

Click to download the PDB-style file with coordinates for d1g0ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ua_: