Lineage for d1rypt_ (1ryp T:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335658Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 335743Protein Proteasome alpha subunit (non-catalytic) [56255] (4 species)
    contains an extension to the common fold at the N-teminus
  7. 335774Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 335787Domain d1rypt_: 1ryp T: [41944]
    Other proteins in same PDB: d1ryp1_, d1ryp2_, d1ryph_, d1rypi_, d1rypj_, d1rypk_, d1rypl_, d1rypm_, d1rypn_, d1rypv_, d1rypw_, d1rypx_, d1rypy_, d1rypz_

Details for d1rypt_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rypt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypt_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOP Domain Coordinates for d1rypt_:

Click to download the PDB-style file with coordinates for d1rypt_.
(The format of our PDB-style files is described here.)

Timeline for d1rypt_: