Lineage for d1rypn_ (1ryp N:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138590Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 138720Protein Proteasome beta subunit (catalytic) [56252] (2 species)
  7. 138736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
  8. 138745Domain d1rypn_: 1ryp N: [41882]
    Other proteins in same PDB: d1rypa_, d1rypb_, d1rypc_, d1rypd_, d1rype_, d1rypf_, d1rypg_, d1rypo_, d1rypp_, d1rypq_, d1rypr_, d1ryps_, d1rypt_, d1rypu_

Details for d1rypn_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rypn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rypn_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOP Domain Coordinates for d1rypn_:

Click to download the PDB-style file with coordinates for d1rypn_.
(The format of our PDB-style files is described here.)

Timeline for d1rypn_: