Class a: All alpha proteins [46456] (290 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.2: Allosteric chorismate mutase [48604] (2 proteins) duplication: 2 weak structural repeats resembling subunits of E. coli protein |
Protein automated matches [419273] (1 species) not a true protein |
Species Candida albicans [TaxId:237561] [420145] (1 PDB entry) |
Domain d7rj1b1: 7rj1 B:1-266 [418698] Other proteins in same PDB: d7rj1a2, d7rj1b2, d7rj1c2, d7rj1d2 automated match to d3csma_ complexed with edo, mg, trp, trs |
PDB Entry: 7rj1 (more details), 2.16 Å
SCOPe Domain Sequences for d7rj1b1:
Sequence, based on SEQRES records: (download)
>d7rj1b1 a.130.1.2 (B:1-266) automated matches {Candida albicans [TaxId: 237561]} mdfmkpetvldlanirqalvrmedtivfdliersqffsspsvyeknkynipnfdgtflew allqlevahsqirryeapdetpffpdqlktpilppinypkilakysdeinvnseimkfyv deivpqvscgqgdqkenlgsastcdieclqaisrrihfgkfvaeakyqsdkplyiklild kdvkgiensitnsaveqkilerlivkaesygvdpslkfgqnvqskvkpeviaklykdwii pltkkveidyllrrlededvelveky
>d7rj1b1 a.130.1.2 (B:1-266) automated matches {Candida albicans [TaxId: 237561]} mdfmkpetvldlanirqalvrmedtivfdliersqffsspsvyeknkynipnfdgtflew allqlevahsqirryeapdetpffpdqlktpilppinypkilakysdeinvnseimkfyv deivpqvscgqgdqkenlgsastcdieclqaisrrihfgkfvaeakyqsdkplyiklild kdvkgiensitnsaveqkilerlivkaesygvdpslkqnvqskvkpeviaklykdwiipl tkkveidyllrrlededvelveky
Timeline for d7rj1b1: