Lineage for d1pmap_ (1pma P:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138590Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 138720Protein Proteasome beta subunit (catalytic) [56252] (2 species)
  7. 138721Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (1 PDB entry)
  8. 138725Domain d1pmap_: 1pma P: [41863]
    Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_

Details for d1pmap_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum

SCOP Domain Sequences for d1pmap_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmap_ d.153.1.4 (P:) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1pmap_:

Click to download the PDB-style file with coordinates for d1pmap_.
(The format of our PDB-style files is described here.)

Timeline for d1pmap_: