SCOPe 2.08: Domain d7r6wl2: 7r6w L:115-216

Lineage for d7r6wl2 (7r6w L:115-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7r6wl2: 7r6w L:115-216 [418620]
   Other proteins in same PDB: d7r6wb_, d7r6wh_, d7r6wl1, d7r6wr_
   automated match to d6jp7l2
   complexed with cl, gol, pol, so4

Details for d7r6wl2

PDB Entry: 7r6w, 1.83 Å

PDB Description: sars-cov-2 spike receptor-binding domain (rbd) in complex with s2x35 fab and s309 fab

PDB Compounds: (L:) Light Chain of Fab domain of monoclonal antibody S2X35

SCOPe Domain Sequences for d7r6wl2:

Sequence; same for both SEQRES and ATOM records:

>d7r6wl2 b.1.1.2 (L:115-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d7r6wl2:

• d7r6wl2 is new in SCOPe 2.08-stable