Lineage for d7lbal_ (7lba L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874326Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2874327Protein automated matches [190626] (14 species)
    not a true protein
  7. 2874385Species Escherichia coli [TaxId:562] [403527] (2 PDB entries)
  8. 2874395Domain d7lbal_: 7lba L: [418271]
    automated match to d7lola_
    complexed with mn

Details for d7lbal_

PDB Entry: 7lba (more details), 2.2 Å

PDB Description: e. coli agmatinase
PDB Compounds: (L:) agmatinase

SCOPe Domain Sequences for d7lbal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lbal_ c.42.1.0 (L:) automated matches {Escherichia coli [TaxId: 562]}
stlghqydnslvsnafgflrlpmnfqpydsdadwvitgvpfdmatsgraggrhgpaairq
vstnlawehnrfpwnfdmrerlnvvdcgdlvyafgdaremseklqahaekllaagkrmls
fggdhfvtlpllrahakhfgkmalvhfdahtdtyangcefdhgtmfytapkeglidpnhs
vqigirtefdkdngftvldacqvndrsvddviaqvkqivgdmpvyltfdidcldpafapg
tgtpviggltsdraiklvrglkdlnivgmdvvevapaydqseitalaaatlalemlyiqa
ak

SCOPe Domain Coordinates for d7lbal_:

Click to download the PDB-style file with coordinates for d7lbal_.
(The format of our PDB-style files is described here.)

Timeline for d7lbal_:

  • d7lbal_ is new in SCOPe 2.08-stable