Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d7e4zf2: 7e4z F:77-378 [418044] Other proteins in same PDB: d7e4za1, d7e4za2, d7e4zb1, d7e4zb2, d7e4zc1, d7e4zc2, d7e4zd1, d7e4zd2, d7e4ze_, d7e4zf1, d7e4zf3 automated match to d3tiia2 complexed with acp, bkl, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 7e4z (more details), 2.69 Å
SCOPe Domain Sequences for d7e4zf2:
Sequence, based on SEQRES records: (download)
>d7e4zf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d7e4zf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakssegilis seaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrt ssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttlensi llqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqkly aelcqgivdvaissvfplatsifikl
Timeline for d7e4zf2: