Lineage for d7e4ze_ (7e4z E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734023Domain d7e4ze_: 7e4z E: [418042]
    Other proteins in same PDB: d7e4za1, d7e4za2, d7e4zb1, d7e4zb2, d7e4zc1, d7e4zc2, d7e4zd1, d7e4zd2, d7e4zf1, d7e4zf2, d7e4zf3
    automated match to d6qtne_
    complexed with acp, bkl, ca, cl, gdp, gtp, mes, mg

Details for d7e4ze_

PDB Entry: 7e4z (more details), 2.69 Å

PDB Description: crystal structure of tubulin in complex with maytansinol
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7e4ze_:

Sequence, based on SEQRES records: (download)

>d7e4ze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d7e4ze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d7e4ze_:

Click to download the PDB-style file with coordinates for d7e4ze_.
(The format of our PDB-style files is described here.)

Timeline for d7e4ze_:

  • d7e4ze_ is new in SCOPe 2.08-stable