Lineage for d1b25d2 (1b25 D:1-210)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84785Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
  4. 84786Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
  5. 84787Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)
  6. 84792Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species)
  7. 84793Species Archaeon Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries)
  8. 84797Domain d1b25d2: 1b25 D:1-210 [41799]
    Other proteins in same PDB: d1b25a1, d1b25b1, d1b25c1, d1b25d1

Details for d1b25d2

PDB Entry: 1b25 (more details), 1.85 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus

SCOP Domain Sequences for d1b25d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b25d2 d.152.1.1 (D:1-210) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva

SCOP Domain Coordinates for d1b25d2:

Click to download the PDB-style file with coordinates for d1b25d2.
(The format of our PDB-style files is described here.)

Timeline for d1b25d2: