SCOPe 2.08: Domain d1b25d2: 1b25 D:1-210

Lineage for d1b25d2 (1b25 D:1-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
   contains sandwich; duplication of alpha+beta motif with single mixed sheet
   motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel

4. Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family)
   automatically mapped to Pfam PF02730

5. Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)

6. Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries)

8. Domain d1b25d2: 1b25 D:1-210 [41799]
   Other proteins in same PDB: d1b25a1, d1b25b1, d1b25c1, d1b25d1
   complexed with ptt, sf4

Details for d1b25d2

PDB Entry: 1b25, 1.85 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus

PDB Compounds: (D:) protein (formaldehyde ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b25d2:

Sequence; same for both SEQRES and ATOM records:

>d1b25d2 d.152.1.1 (D:1-210) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva

Timeline for d1b25d2:

• d1b25d2 first appeared (with stable ids) in SCOP 1.55
  
• d1b25d2 appears in SCOPe 2.07