Lineage for d1b25d2 (1b25 D:1-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988322Fold d.152: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56227] (1 superfamily)
    contains sandwich; duplication of alpha+beta motif with single mixed sheet
    motif: beta(2)-alpha-beta(3)-alpha-beta; strand order 216345, strands 1 and 6 are parallel
  4. 2988323Superfamily d.152.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56228] (1 family) (S)
    automatically mapped to Pfam PF02730
  5. 2988324Family d.152.1.1: Aldehyde ferredoxin oxidoreductase, N-terminal domain [56229] (2 proteins)
  6. 2988329Protein Formaldehyde ferredoxin oxidoreductase [56232] (1 species)
  7. 2988330Species Pyrococcus furiosus [TaxId:2261] [56233] (2 PDB entries)
  8. 2988334Domain d1b25d2: 1b25 D:1-210 [41799]
    Other proteins in same PDB: d1b25a1, d1b25b1, d1b25c1, d1b25d1
    complexed with ptt, sf4

Details for d1b25d2

PDB Entry: 1b25 (more details), 1.85 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus
PDB Compounds: (D:) protein (formaldehyde ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b25d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b25d2 d.152.1.1 (D:1-210) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
mygwwgrilrvnlttgevkvqeypeevakkfiggrglaawilwneargveplspenklif
aagpfnglptpsggklvvaakspltggygdgnlgtmasvhlrragydalvvegkakkpvy
iyieddnvsilsaeglwgkttfeterelkeihgknvgvltigpagenlvkyavvisqegr
aagrpgmgavmgskklkavvirgtkeipva

SCOPe Domain Coordinates for d1b25d2:

Click to download the PDB-style file with coordinates for d1b25d2.
(The format of our PDB-style files is described here.)

Timeline for d1b25d2: