Lineage for d7d0qa_ (7d0q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968763Species Human (Homo sapiens) [TaxId:9606] [187321] (16 PDB entries)
  8. 2968771Domain d7d0qa_: 7d0q A: [417876]
    automated match to d5j9ta_
    complexed with bco, cl, edo, zn

Details for d7d0qa_

PDB Entry: 7d0q (more details), 2.21 Å

PDB Description: crystal structure of human hbo1-brpf2 in complex with butyryl-coenzyme a
PDB Compounds: (A:) Histone acetyltransferase KAT7

SCOPe Domain Sequences for d7d0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d0qa_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewiakeakrsnsnktmdpsclkwtppkgt

SCOPe Domain Coordinates for d7d0qa_:

Click to download the PDB-style file with coordinates for d7d0qa_.
(The format of our PDB-style files is described here.)

Timeline for d7d0qa_:

  • d7d0qa_ is new in SCOPe 2.08-stable