Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.1: DNase I-like [56220] (7 proteins) |
Protein DNA repair endonuclease Hap1 [56223] (1 species) Major apurinic/apyrimidinic endonuclease APE1 |
Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries) |
Domain d1dewa_: 1dew A: [41786] protein/DNA complex; complexed with so4 |
PDB Entry: 1dew (more details), 2.65 Å
SCOPe Domain Sequences for d1dewa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dewa_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} gpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcs enklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviva efdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidl rnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgw rldyfllshsllpalcdskirskalgsdhcpitlylal
Timeline for d1dewa_: