PDB entry 1dew

View 1dew on RCSB PDB site
Description: crystal structure of human ape1 bound to abasic DNA
Class: lyase/DNA
Keywords: enzyme:DNA complex, DNA repair, abasic site, lyase/DNA complex
Deposited on 1999-11-15, released 2000-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dewa_
  • Chain 'B':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dewb_
  • Chain 'U':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*(3dr)p*cp*gp*ap*cp*gp*ap*cp*g)-3'
  • Chain 'V':
    Compound: 5'-d(*gp*tp*cp*gp*tp*cp*gp*gp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'X':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*(3dr)p*cp*gp*ap*cp*gp*ap*cp*g)-3'
  • Chain 'Y':
    Compound: 5'-d(*gp*tp*cp*gp*tp*cp*gp*gp*gp*gp*ap*cp*gp*c)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dewA (A:)
    egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
    senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
    aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
    lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
    wrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dewA (A:)
    gpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcs
    enklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviva
    efdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidl
    rnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgw
    rldyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dewB (B:)
    egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
    senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
    aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
    lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
    wrldyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.