SCOPe 2.02: Domain d1de9b_: 1de9 B:

Lineage for d1de9b_ (1de9 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
   Major apurinic/apyrimidinic endonuclease APE1

7. Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)

8. Domain d1de9b_: 1de9 B: [41785]
   protein/DNA complex; complexed with mn

Details for d1de9b_

PDB Entry: 1de9, 3 Å

PDB Description: human ape1 endonuclease with bound abasic dna and mn2+ ion

PDB Compounds: (B:) major apurinic/apyrimidinic endonuclease

SCOPe Domain Sequences for d1de9b_:

Sequence; same for both SEQRES and ATOM records:

>d1de9b_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d1de9b_:

• d1de9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1de9b_ appears in SCOPe 2.01
  
• d1de9b_ appears in SCOPe 2.03
  
• d1de9b_ appears in the current release, SCOPe 2.08