Lineage for d1bixa_ (1bix A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676255Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1676278Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 1676279Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)
  8. 1676281Domain d1bixa_: 1bix A: [41781]
    complexed with pt, sm

Details for d1bixa_

PDB Entry: 1bix (more details), 2.2 Å

PDB Description: the crystal structure of the human dna repair endonuclease hap1 suggests the recognition of extra-helical deoxyribose at dna abasic sites
PDB Compounds: (A:) ap endonuclease 1

SCOPe Domain Sequences for d1bixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bixa_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1bixa_:

Click to download the PDB-style file with coordinates for d1bixa_.
(The format of our PDB-style files is described here.)

Timeline for d1bixa_: