SCOPe 2.08: Domain d7c0wa1: 7c0w A:1-395

Lineage for d7c0wa1 (7c0w A:1-395)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries)

8. Domain d7c0wa1: 7c0w A:1-395 [417706]
   Other proteins in same PDB: d7c0wa2, d7c0wb2
   automated match to d7bvta_
   complexed with co2, edo, fgo, gol, na

Details for d7c0wa1

PDB Entry: 7c0w, 2.1 Å

PDB Description: crystal structure of a dinucleotide-binding protein (y224a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii)

PDB Compounds: (A:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d7c0wa1:

Sequence; same for both SEQRES and ATOM records:

>d7c0wa1 c.94.1.0 (A:1-395) automated matches {Thermus thermophilus [TaxId: 300852]}
kpedvikeqcarakvvaelwhgftggapkaalenlvvefnkaqqgrcvrpvpqggyrdls
tkikaafaagkvptmaqafennialyleakallpieslgvklqgvnltflnavrfggvvy
gvpfnksiqvlyynkdllkkhgvpvpatleefvaaakklsraeggpvywfqpdastfayf
ffnlggsylkdgklvlnskeavealtllqngvkegwakpitsgainqnlgsgpyafsvdt
sagytyylraakfdlgvatlpgrtkgqpgyglvqgtnlvvfrqaskeeqavakdflefvl
spraqavfatatgyvpvtegalkdpvyqayaaenpdyativrqsryakfepalaeweqir
fdilgqaikeailnkadpkaaldraqklaedllss

Timeline for d7c0wa1:

• d7c0wa1 is new in SCOPe 2.08-stable