Lineage for d1ffuc2 (1ffu C:1-177)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512608Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins)
  6. 512609Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 512610Species Hydrogenophaga pseudoflava [TaxId:47421] [56190] (2 PDB entries)
  8. 512613Domain d1ffuc2: 1ffu C:1-177 [41756]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffud1, d1ffud2, d1ffue1, d1ffue2, d1ffuf1

Details for d1ffuc2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffuc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava}
mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaa

SCOP Domain Coordinates for d1ffuc2:

Click to download the PDB-style file with coordinates for d1ffuc2.
(The format of our PDB-style files is described here.)

Timeline for d1ffuc2: