Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.145: FAD-binding domain [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding domain [56176] (3 families) |
Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins) |
Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species) |
Species Hydrogenophaga pseudoflava [TaxId:47421] [56190] (2 PDB entries) |
Domain d1ffuc2: 1ffu C:1-177 [41756] Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffud1, d1ffud2, d1ffue1, d1ffue2, d1ffuf1 |
PDB Entry: 1ffu (more details), 2.35 Å
SCOP Domain Sequences for d1ffuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffuc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava} mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaa
Timeline for d1ffuc2: