SCOP 1.69: Domain d1ffud2: 1ffu D:2-81

Lineage for d1ffud2 (1ffu D:2-81)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (11 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)

8. Domain d1ffud2: 1ffu D:2-81 [37703]
   Other proteins in same PDB: d1ffua1, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud1, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2

Details for d1ffud2

PDB Entry: 1ffu, 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffud2:

Sequence; same for both SEQRES and ATOM records:

>d1ffud2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava}
akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
cthlavqcdgsevltvegla

Timeline for d1ffud2:

• d1ffud2 first appeared (with stable ids) in SCOP 1.55
  
• d1ffud2 appears in SCOP 1.67
  
• d1ffud2 appears in SCOP 1.71
  
• d1ffud2 appears in the current release, SCOPe 2.08