Lineage for d1f0xb2 (1f0x B:1009-1273)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1933670Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1933671Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1933672Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins)
  6. 1933691Protein D-lactate dehydrogenase [56182] (1 species)
  7. 1933692Species Escherichia coli [TaxId:562] [56183] (1 PDB entry)
  8. 1933694Domain d1f0xb2: 1f0x B:1009-1273 [41747]
    Other proteins in same PDB: d1f0xa1, d1f0xb1
    complexed with fad

Details for d1f0xb2

PDB Entry: 1f0x (more details), 1.9 Å

PDB Description: crystal structure of d-lactate dehydrogenase, a peripheral membrane respiratory enzyme.
PDB Compounds: (B:) d-lactate dehydrogenase

SCOPe Domain Sequences for d1f0xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0xb2 d.145.1.1 (B:1009-1273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]}
nkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwrvlkacvta
dkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlaypgttlysle
kalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarinedgkltlv
nhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtparynadpd
rlfessgcagklavfavrldtfeae

SCOPe Domain Coordinates for d1f0xb2:

Click to download the PDB-style file with coordinates for d1f0xb2.
(The format of our PDB-style files is described here.)

Timeline for d1f0xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f0xb1