SCOPe 2.06: Domain d1f0xb2: 1f0x B:1009-1273

Lineage for d1f0xb2 (1f0x B:1009-1273)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein D-lactate dehydrogenase [56182] (1 species)

7. Species Escherichia coli [TaxId:562] [56183] (1 PDB entry)

8. Domain d1f0xb2: 1f0x B:1009-1273 [41747]
   Other proteins in same PDB: d1f0xa1, d1f0xb1
   complexed with fad

Details for d1f0xb2

PDB Entry: 1f0x, 1.9 Å

PDB Description: crystal structure of d-lactate dehydrogenase, a peripheral membrane respiratory enzyme.

PDB Compounds: (B:) d-lactate dehydrogenase

SCOPe Domain Sequences for d1f0xb2:

Sequence; same for both SEQRES and ATOM records:

>d1f0xb2 d.145.1.1 (B:1009-1273) D-lactate dehydrogenase {Escherichia coli [TaxId: 562]}
nkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwrvlkacvta
dkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlaypgttlysle
kalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarinedgkltlv
nhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtparynadpd
rlfessgcagklavfavrldtfeae

Timeline for d1f0xb2:

• d1f0xb2 first appeared (with stable ids) in SCOP 1.55
  
• d1f0xb2 appears in SCOPe 2.05
  
• d1f0xb2 appears in SCOPe 2.07
  
• d1f0xb2 appears in the current release, SCOPe 2.08