![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.145: FAD-binding domain [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding domain [56176] (3 families) ![]() |
![]() | Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins) |
![]() | Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species) the other subunit is a short-chain cytochrome c |
![]() | Species Pseudomonas putida [TaxId:303] [56181] (2 PDB entries) |
![]() | Domain d1diqa2: 1diq A:7-242 [41742] Other proteins in same PDB: d1diqa1, d1diqb1, d1diqc_, d1diqd_ |
PDB Entry: 1diq (more details), 2.75 Å
SCOP Domain Sequences for d1diqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida} avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1diqa2:
![]() Domains from other chains: (mouse over for more information) d1diqb1, d1diqb2, d1diqc_, d1diqd_ |