SCOP 1.67: Domain d1diqa1: 1diq A:243-521

Lineage for d1diqa1 (1diq A:243-521)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
   the other subunit is a short-chain cytochrome c

7. Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)

8. Domain d1diqa1: 1diq A:243-521 [39479]
   Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_

Details for d1diqa1

PDB Entry: 1diq, 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

SCOP Domain Sequences for d1diqa1:

Sequence; same for both SEQRES and ATOM records:

>d1diqa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

Timeline for d1diqa1:

• d1diqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1diqa1 appears in SCOP 1.65
  
• d1diqa1 appears in SCOP 1.69
  
• d1diqa1 appears in the current release, SCOPe 2.08