Lineage for d6yd5a1 (6yd5 A:12-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863218Species Staphylococcus aureus [TaxId:1280] [226386] (16 PDB entries)
  8. 2863222Domain d6yd5a1: 6yd5 A:12-208 [417212]
    Other proteins in same PDB: d6yd5a2, d6yd5a3
    automated match to d4m8ia1
    complexed with edo, gdp, k, mb3, om8

Details for d6yd5a1

PDB Entry: 6yd5 (more details), 1.55 Å

PDB Description: saftsz-ucm151 (comp. 18)
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d6yd5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yd5a1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d6yd5a1:

Click to download the PDB-style file with coordinates for d6yd5a1.
(The format of our PDB-style files is described here.)

Timeline for d6yd5a1:

  • d6yd5a1 is new in SCOPe 2.08-stable