Lineage for d4m8ia1 (4m8i A:11-208)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) 
Protein automated matches [226837] (9 species)
not a true protein
Species Staphylococcus epidermidis [TaxId:176279] [227787] (1 PDB entry) 
Domain d4m8ia1: 4m8i A:11-208 [227788]
Other proteins in same PDB: d4m8ia2
automated match to d4dxda1
complexed with gdp, so4
Details for d4m8ia1
PDB Entry: 4m8i (more details), 1.43 Å
PDB Description: 1.43 angstrom resolution crystal structure of cell division protein ftsz (ftsz) from staphylococcus epidermidis rp62a in complex with gdp
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d4m8ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m8ia1 c.32.1.1 (A:11-208) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
latlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
aganpeigkkaaeesreqiedaiqgadmvfvtagmgggtgtgaapvvakiakemgaltvg
vvtrpfgfegrkrqtqaaagvesmkaavdtlivipndrlldivdkstpmmeafkeadnvl
rqgvqgisdliavsgevn
SCOPe Domain Coordinates for d4m8ia1:
Click to download the PDB-style file with coordinates for d4m8ia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4m8ia1:
- d4m8ia1 first appeared in SCOPe 2.03
- d4m8ia1 appears in SCOPe 2.07
View in 3D
