Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
Protein automated matches [226843] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [327472] (14 PDB entries) |
Domain d6yd1a2: 6yd1 A:209-315 [417210] Other proteins in same PDB: d6yd1a1, d6yd1a3 automated match to d4m8ia2 complexed with gdp, k, olq |
PDB Entry: 6yd1 (more details), 1.7 Å
SCOPe Domain Sequences for d6yd1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yd1a2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
Timeline for d6yd1a2: