Lineage for d6yd1a2 (6yd1 A:209-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960066Species Staphylococcus aureus [TaxId:1280] [327472] (14 PDB entries)
  8. 2960073Domain d6yd1a2: 6yd1 A:209-315 [417210]
    Other proteins in same PDB: d6yd1a1, d6yd1a3
    automated match to d4m8ia2
    complexed with gdp, k, olq

Details for d6yd1a2

PDB Entry: 6yd1 (more details), 1.7 Å

PDB Description: saftsz-dfmba
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d6yd1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yd1a2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d6yd1a2:

Click to download the PDB-style file with coordinates for d6yd1a2.
(The format of our PDB-style files is described here.)

Timeline for d6yd1a2:

  • d6yd1a2 is new in SCOPe 2.08-stable