Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Lymphocyte kinase (lck) [56153] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries) |
Domain d1qpea_: 1qpe A: [41688] complexed with pp2, so4 |
PDB Entry: 1qpe (more details), 2 Å
SCOP Domain Sequences for d1qpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpea_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)} kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely qlmrlcwkerpedrptfdylrsvledfftat
Timeline for d1qpea_: