SCOP 1.67: Domain d1qpea_: 1qpe A:

Lineage for d1qpea_ (1qpe A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries)

8. Domain d1qpea_: 1qpe A: [41688]
   complexed with pp2, so4

Details for d1qpea_

PDB Entry: 1qpe, 2 Å

PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors

SCOP Domain Sequences for d1qpea_:

Sequence; same for both SEQRES and ATOM records:

>d1qpea_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat

Timeline for d1qpea_:

• d1qpea_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpea_ appears in SCOP 1.65
  
• d1qpea_ appears in SCOP 1.69
  
• d1qpea_ appears in the current release, SCOPe 2.08