Lineage for d1qpea_ (1qpe A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.2: Tyrosine kinase [56150] (8 proteins) 
Protein Lymphocyte kinase (lck) [56153] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries) 
Domain d1qpea_: 1qpe A: [41688]
Details for d1qpea_
PDB Entry: 1qpe (more details), 2 Å
PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors
SCOP Domain Sequences for d1qpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpea_ d.144.1.2 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat
SCOP Domain Coordinates for d1qpea_:
Click to download the PDB-style file with coordinates for d1qpea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qpea_:
- d1qpea_ appears in SCOP 1.57
- d1qpea_ appears in the current release, SCOPe 2.08
View in 3D