Lineage for d1dawa_ (1daw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612354Protein Protein kinase CK2, alpha subunit [56142] (2 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 612360Species Maize (Zea mays) [TaxId:4577] [56143] (13 PDB entries)
  8. 612372Domain d1dawa_: 1daw A: [41668]
    complexed with anp, mg

Details for d1dawa_

PDB Entry: 1daw (more details), 2.2 Å

PDB Description: crystal structure of a binary complex of protein kinase ck2 (alpha-subunit) and mg-amppnp

SCOP Domain Sequences for d1dawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dawa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

SCOP Domain Coordinates for d1dawa_:

Click to download the PDB-style file with coordinates for d1dawa_.
(The format of our PDB-style files is described here.)

Timeline for d1dawa_: