Lineage for d1dawa_ (1daw A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36366Protein Protein kinase CK2, alpha subunit [56142] (1 species)
  7. 36367Species Maize (Zea mays) [TaxId:4577] [56143] (4 PDB entries)
  8. 36370Domain d1dawa_: 1daw A: [41668]

Details for d1dawa_

PDB Entry: 1daw (more details), 2.2 Å

PDB Description: crystal structure of a binary complex of protein kinase ck2 (alpha-subunit) and mg-amppnp

SCOP Domain Sequences for d1dawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dawa_ d.144.1.1 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

SCOP Domain Coordinates for d1dawa_:

Click to download the PDB-style file with coordinates for d1dawa_.
(The format of our PDB-style files is described here.)

Timeline for d1dawa_: