Lineage for d6rkek_ (6rke K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905283Species Azotobacter vinelandii [TaxId:322710] [258948] (19 PDB entries)
  8. 2905298Domain d6rkek_: 6rke K: [416576]
    automated match to d6rj4e_
    complexed with 8m0, adp, atp, lhw, ljb, m10, mg, moo, po4

Details for d6rkek_

PDB Entry: 6rke (more details), 1.7 Å

PDB Description: molybdenum storage protein - p212121, adp, molybdate
PDB Compounds: (K:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6rkek_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rkek_ c.73.1.0 (K:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
tnsikhvisplarqtlqdrdltrpvagkrpirllpwlqvvkiggrvmdrgadailplvee
lrkllpehrlliltgagvrarhvfsvgldlglpvgslaplaaseagqnghilaamlaseg
vsyvehptvadqlaihlsatravvgsafppyhhhefpgsripphradtgaflladafgaa
gltivenvdgiytadpngpdrgqarflpetsatdlaksegplpvdralldvmatarhier
vqvvnglvpgrltaalrgehvgtlirtgvrpa

SCOPe Domain Coordinates for d6rkek_:

Click to download the PDB-style file with coordinates for d6rkek_.
(The format of our PDB-style files is described here.)

Timeline for d6rkek_:

  • d6rkek_ is new in SCOPe 2.08-stable