Lineage for d6fara_ (6far A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840948Superfamily c.1.34: Glycosyl hydrolase family 99 [418754] (2 families) (S)
    Pfam PF16317
    Includes subdomain made of loops between barrel elements
  5. 2840976Family c.1.34.0: automated matches [418882] (1 protein)
    not a true family
  6. 2840977Protein automated matches [419257] (2 species)
    not a true protein
  7. 2840978Species Bacteroides xylanisolvens [TaxId:657309] [419936] (20 PDB entries)
  8. 2840996Domain d6fara_: 6far A: [415951]
    automated match to d4acya_
    complexed with man, mvl

Details for d6fara_

PDB Entry: 6far (more details), 1.3 Å

PDB Description: structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-mannoimidazole
PDB Compounds: (A:) glycosyl hydrolase family 71

SCOPe Domain Sequences for d6fara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fara_ c.1.34.0 (A:) automated matches {Bacteroides xylanisolvens [TaxId: 657309]}
gteldydtfcfyydwygseaidgqyrhwahaiapdpnggsgqnpgtipgtqesiasnfyp
qlgrysssdpniltkhmdmfvmartgvlaltwwneqdeteakriglildaadkkkikvcf
hlepypsrnvqnlrenivklitrygnhpafyrkdgkplffiydsyliepsewekllspgg
sitirntaydalmiglwtssptvqrpfilnahfdgfytyfaatgftygstptnwvsmqkw
akengkifipsvgpgyidtrirpwngsvirtrtdgqyydamyrkaieagvsaisitsfne
whegsqiepavpytsseftyldyenrepdyyltrtaywvgkfresk

SCOPe Domain Coordinates for d6fara_:

Click to download the PDB-style file with coordinates for d6fara_.
(The format of our PDB-style files is described here.)

Timeline for d6fara_:

  • d6fara_ is new in SCOPe 2.08-stable