Lineage for d4acya_ (4acy A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.34: Glycosyl hydrolase family 99 [418754] (2 families) 
Pfam PF16317
Includes subdomain made of loops between barrel elements
Family c.1.34.1: Glycosyl hydrolase family 99 [418827] (2 proteins) 
Protein Endo-alpha-mannosidase [419147] (1 species) Species Bacteroides thetaiotaomicron [TaxId:226186] [419669] (3 PDB entries) 
Domain d4acya_: 4acy A: [413641]
complexed with fmt, gol
Details for d4acya_
PDB Entry: 4acy (more details), 1.69 Å
PDB Description: selenomethionine derivative of the gh99 endo-alpha-mannosidase from bacteroides thetaiotaomicron
PDB Compounds: (A:) endo-alpha-mannosidaseSCOPe Domain Sequences for d4acya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acya_ c.1.34.1 (A:) Endo-alpha-mannosidase {Bacteroides thetaiotaomicron [TaxId: 226186]}
tlddhtisfyynwygnpsvdgemkhwmhpialapghsgdvgaisglnddiacnfypelgt
yssndpeiirkhirmhikanvgvlsvtwwgesdygnqsvsllldeaakvgakvcfhiepf
ngrspqtvreniqyivdtygdhpafyrthgkplffiydsylikpaewaklfaaggeisvr
ntkydglfigltlkeselpdietacmdgfytyfaatgftnastpanwksmqqwakahnkl
fipsvgpgyidtrirpwngsttrdrengkyyddmykaaiesgasyisitsfnewhegtqi
epavskkcdafeyldykpladdyylirtaywvdefrkarsa
SCOPe Domain Coordinates for d4acya_:
Click to download the PDB-style file with coordinates for d4acya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4acya_:
- d4acya_ is new in SCOPe 2.08-stable
View in 3D
