![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.34: Glycosyl hydrolase family 99 [418754] (2 families) ![]() Pfam PF16317 Includes subdomain made of loops between barrel elements |
![]() | Family c.1.34.1: Glycosyl hydrolase family 99 [418827] (2 proteins) |
![]() | Protein Endo-alpha-mannosidase [419147] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [419669] (3 PDB entries) |
![]() | Domain d4acyb_: 4acy B: [413642] automated match to d4acya_ complexed with fmt, gol |
PDB Entry: 4acy (more details), 1.69 Å
SCOPe Domain Sequences for d4acyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acyb_ c.1.34.1 (B:) Endo-alpha-mannosidase {Bacteroides thetaiotaomicron [TaxId: 226186]} tlddhtisfyynwygnpsvdgemkhwmhpialapghsgdvgaisglnddiacnfypelgt yssndpeiirkhirmhikanvgvlsvtwwgesdygnqsvsllldeaakvgakvcfhiepf ngrspqtvreniqyivdtygdhpafyrthgkplffiydsylikpaewaklfaaggeisvr ntkydglfigltlkeselpdietacmdgfytyfaatgftnastpanwksmqqwakahnkl fipsvgpgyidtrirpwngsttrdrengkyyddmykaaiesgasyisitsfnewhegtqi epavskkcdafeyldykpladdyylirtaywvdefrkarsa
Timeline for d4acyb_: