Class g: Small proteins [56992] (100 folds) |
Fold g.103: Protein-only RNAse P central domain-like [418734] (1 superfamily) core: 4-stranded antiparallel beta sheet that coordinates zinc, order 1432 |
Superfamily g.103.1: Protein-only RNAse P central domain-like [418780] (1 family) |
Family g.103.1.1: Protein-only RNAse P central domain-like [418870] (1 protein) |
Protein Proteinaceous RNAse P1 (PRORP1) [419227] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419752] (8 PDB entries) |
Domain d6bv5a2: 6bv5 A:300-352,A:535-570 [415745] Other proteins in same PDB: d6bv5a1, d6bv5a3 automated match to d4g25a3 protein/RNA complex; complexed with cl, jug, mn, zn |
PDB Entry: 6bv5 (more details), 1.79 Å
SCOPe Domain Sequences for d6bv5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bv5a2 g.103.1.1 (A:300-352,A:535-570) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gvkkwdvkkirdavvsggggwhgqgwlgtgkwnvkrtemdengvckcckeklvXysiviq esedgtwhvpmsveddlqtsrqwlcakrsk
Timeline for d6bv5a2: