Lineage for d5wp6b2 (5wp6 B:393-583)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006531Protein Calcium-activated non-selective cation channel TRPM4 [419151] (1 species)
  7. 3006532Species Human (Homo sapiens) [TaxId:9606] [419673] (1 PDB entry)
  8. 3006533Domain d5wp6b2: 5wp6 B:393-583 [415541]
    Other proteins in same PDB: d5wp6b1, d5wp6b3
    complexed with dvt

Details for d5wp6b2

PDB Entry: 5wp6 (more details), 3.8 Å

PDB Description: cryo-em structure of a human trpm4 channel in complex with calcium and decavanadate
PDB Compounds: (B:) Transient receptor potential cation channel subfamily M member 4

SCOPe Domain Sequences for d5wp6b2:

Sequence, based on SEQRES records: (download)

>d5wp6b2 d.211.1.1 (B:393-583) Calcium-activated non-selective cation channel TRPM4 {Human (Homo sapiens) [TaxId: 9606]}
yldelrlavawnrvdiaqselfrgdiqwrsfhleaslmdallndrpefvrllishglslg
hfltpmrlaqlysaapsnslirnlldqashsagtkapalkggaaelrppdvghvlrmllg
kmcaprypsggawdphpgqgfgesmyllsdkatsplsldaglgqapwsdlllwalllnra
qmamyfwemgs

Sequence, based on observed residues (ATOM records): (download)

>d5wp6b2 d.211.1.1 (B:393-583) Calcium-activated non-selective cation channel TRPM4 {Human (Homo sapiens) [TaxId: 9606]}
yldelrlavawnrvdiaqselfrgdiqwrsfhleaslmdallndrpefvrllishglslg
hfltpmrlaqlysaapsnslirnlldqapwsdlllwalllnraqmamyfwemgs

SCOPe Domain Coordinates for d5wp6b2:

Click to download the PDB-style file with coordinates for d5wp6b2.
(The format of our PDB-style files is described here.)

Timeline for d5wp6b2:

  • d5wp6b2 is new in SCOPe 2.08-stable