Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Calcium-activated non-selective cation channel TRPM4 [419151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419673] (1 PDB entry) |
Domain d5wp6b2: 5wp6 B:393-583 [415541] Other proteins in same PDB: d5wp6b1, d5wp6b3 complexed with dvt |
PDB Entry: 5wp6 (more details), 3.8 Å
SCOPe Domain Sequences for d5wp6b2:
Sequence, based on SEQRES records: (download)
>d5wp6b2 d.211.1.1 (B:393-583) Calcium-activated non-selective cation channel TRPM4 {Human (Homo sapiens) [TaxId: 9606]} yldelrlavawnrvdiaqselfrgdiqwrsfhleaslmdallndrpefvrllishglslg hfltpmrlaqlysaapsnslirnlldqashsagtkapalkggaaelrppdvghvlrmllg kmcaprypsggawdphpgqgfgesmyllsdkatsplsldaglgqapwsdlllwalllnra qmamyfwemgs
>d5wp6b2 d.211.1.1 (B:393-583) Calcium-activated non-selective cation channel TRPM4 {Human (Homo sapiens) [TaxId: 9606]} yldelrlavawnrvdiaqselfrgdiqwrsfhleaslmdallndrpefvrllishglslg hfltpmrlaqlysaapsnslirnlldqapwsdlllwalllnraqmamyfwemgs
Timeline for d5wp6b2: