Lineage for d1cs0g5 (1cs0 G:128-402)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334707Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 334708Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 334728Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 334737Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 334738Species Escherichia coli [TaxId:562] [56077] (9 PDB entries)
  8. 334753Domain d1cs0g5: 1cs0 G:128-402 [41524]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a3, d1cs0a4, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c3, d1cs0c4, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e3, d1cs0e4, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g3, d1cs0g4, d1cs0h1, d1cs0h2

Details for d1cs0g5

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0g5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0g5 d.142.1.2 (G:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1cs0g5:

Click to download the PDB-style file with coordinates for d1cs0g5.
(The format of our PDB-style files is described here.)

Timeline for d1cs0g5: