Lineage for d1cs0e4 (1cs0 E:556-676)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312607Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 312608Superfamily c.30.1: PreATP-grasp domain [52440] (5 families) (S)
    preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 312609Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 312618Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 312619Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)
  8. 312633Domain d1cs0e4: 1cs0 E:556-676 [31678]
    Other proteins in same PDB: d1cs0a1, d1cs0a2, d1cs0a5, d1cs0a6, d1cs0b1, d1cs0b2, d1cs0c1, d1cs0c2, d1cs0c5, d1cs0c6, d1cs0d1, d1cs0d2, d1cs0e1, d1cs0e2, d1cs0e5, d1cs0e6, d1cs0f1, d1cs0f2, d1cs0g1, d1cs0g2, d1cs0g5, d1cs0g6, d1cs0h1, d1cs0h2

Details for d1cs0e4

PDB Entry: 1cs0 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde

SCOP Domain Sequences for d1cs0e4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs0e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1cs0e4:

Click to download the PDB-style file with coordinates for d1cs0e4.
(The format of our PDB-style files is described here.)

Timeline for d1cs0e4: