Lineage for d1hnzh_ (1hnz H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978288Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2978299Domain d1hnzh_: 1hnz H: [41470]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzh_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1hnzh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1hnzh_:

Click to download the PDB-style file with coordinates for d1hnzh_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzh_: