| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
| Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
| Protein Ribosomal protein S8 [56049] (2 species) |
| Species Thermus thermophilus [TaxId:274] [56051] (7 PDB entries) |
| Domain d1hnzh_: 1hnz H: [41470] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw
Timeline for d1hnzh_: