Lineage for d1bysa_ (1bys A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219122Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 1219123Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 1219124Family d.136.1.1: Nuclease [56025] (1 protein)
  6. 1219125Protein Nuclease Nuc [56026] (1 species)
  7. 1219126Species Salmonella typhimurium [TaxId:90371] [56027] (2 PDB entries)
  8. 1219128Domain d1bysa_: 1bys A: [41451]
    complexed with wo4

Details for d1bysa_

PDB Entry: 1bys (more details), 2 Å

PDB Description: crystal structure of nuc complexed with tungstate
PDB Compounds: (A:) protein (endonuclease)

SCOPe Domain Sequences for d1bysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bysa_ d.136.1.1 (A:) Nuclease Nuc {Salmonella typhimurium [TaxId: 90371]}
epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid
ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns
enavviwnmpklaesflehwqdrwnqgrdyrs

SCOPe Domain Coordinates for d1bysa_:

Click to download the PDB-style file with coordinates for d1bysa_.
(The format of our PDB-style files is described here.)

Timeline for d1bysa_: