![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
![]() | Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) ![]() |
![]() | Family d.136.1.1: Nuclease [56025] (1 protein) automatically mapped to Pfam PF13091 |
![]() | Protein Nuclease Nuc [56026] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [56027] (2 PDB entries) |
![]() | Domain d1byra_: 1byr A: [41450] |
PDB Entry: 1byr (more details), 2 Å
SCOPe Domain Sequences for d1byra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byra_ d.136.1.1 (A:) Nuclease Nuc {Salmonella typhimurium [TaxId: 90371]} epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns enavviwnmpklaesflehwqdrwnqgrdyrs
Timeline for d1byra_: