Lineage for d1byra_ (1byr A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36037Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
  4. 36038Superfamily d.136.1: Phospholipase D/nuclease [56024] (1 family) (S)
  5. 36039Family d.136.1.1: Phospholipase D/nuclease [56025] (1 protein)
  6. 36040Protein Nuclease Nuc [56026] (1 species)
  7. 36041Species Salmonella typhimurium [TaxId:90371] [56027] (2 PDB entries)
  8. 36042Domain d1byra_: 1byr A: [41450]

Details for d1byra_

PDB Entry: 1byr (more details), 2 Å

PDB Description: crystal structure of a phospholipase d family member, nuc from salmonella typhimurium

SCOP Domain Sequences for d1byra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byra_ d.136.1.1 (A:) Nuclease Nuc {Salmonella typhimurium}
epsvqvgyspegsarvlvlsaidsaktsirmmaysftapdimkalvaakkrgvdvkivid
ergntgrasiaamnyiansgiplrtdsnfpiqhdkviivdnvtvetgsfnftkaaetkns
enavviwnmpklaesflehwqdrwnqgrdyrs

SCOP Domain Coordinates for d1byra_:

Click to download the PDB-style file with coordinates for d1byra_.
(The format of our PDB-style files is described here.)

Timeline for d1byra_: